link slot depo 10rb-🎖️game memancing yang menggerakkan hp|XOXE88.COM

KomisionerKomnasHAMMohammadChoirulAnam.Foto:Ricardojpnn.com,JAKARTA-KuasahukumkeluargaNopriansyahYoshuaHutabarataliasBrigadirJ,KamaruddinSimanjuntakmenyebutotakjenazahBrigadirJtidakberadapadatempatnyaatauberpindahkebagiandada.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menanggapiisuitu,KomisiNasionalHakAsasiManusia(KomnasHAM)engganmemberikanpernyataandanlebihmemilihmenungguhasilautopsi.BacaJuga:Kamaruddin:DokterKeluargaMenemulink slot depo 10rbkanOtakBrigadirJdiBagianDadaKamipercayapenjelasanketuatimyangmelakukanautopsidiJambidanmelibatkanberbagaiprofesordariberbagaiuniversitas.Kamitungguitusaja,kataKomisionerKomnasHAMRIMohammadChoirulAnamdiJakarta,Senin.Akantetapi,Anammenyarankanhal-halyangmenyangkutkedokteranforensiksebaiknyaditanyakanlangsungkepihakyangberwenangatauahlidibidangtersebut.Apalagi,katadia,terdapatbeberapadokterdariberbagaiuniversitasyangterlibatlangsungdariprosesautopsiulangjenazahBrigadirJ.BacaJuga:SoalKasusKematianBrigadirJ,AnamSorotiKerjaTimsusBentukanKapolri,JlebBangetTerkaitpemeriksaanAjudandanAsistenRumahTanggaKadivPropamPolrinonaktifIrjenPolisiFerdySambohariini(1/8),AnammengatakantimdariKomnasHAMmenggalisemuahalyangberkaitanlangsungdenganpihak-pihakdalamkonstruksiperistiwatersebut.IamengatakanterdapatfaktabaruyangdidapatkanKomnasHAM,khususnyayangterjadisaatrombonganIrjenPolisiFerdySambotermasukBrigadirJberadadiMagelang,JawaTengah.

PetugasPolresSelumasaatmelakukanrekonstruksipembunuhananggotaTNIdiMapoldaBengkulu.ANTARA/AnggiMayasarijpnn.com,SELUMA-NyawaanggotaTNIKodim0425/SelumaSersanKepala(Serka)HalilPutramelayangditanganS.PembunuhanterjadidikebunsawitmilikSyangterletakdikawasanAmparGading,KelurahanLubukKebur,KecamatanSelumaKota,KabupatenSeluma,Bengkulu.TersangkaSmenjalani34adeganrekonstruksidiLapanganMapoldaBengkulu,Rabu.BacaJuga:BrigjenTNISembiring:SayaAkanBertanggungJawabBilaAdaPrajurityangTerlibatKasatReskrimPolresSelumaAKPDwiHandoyomengatakanrekonstruksidiawalidengantersangkapergikesalahsatupondokkecildikebunsawitmiliknya.Rekonstruksidilakukansebanyak34adeganyangdilakukandiMapoldaBengkulu,tetapitetapditanganiPolresSeluma,kataAKPDwiHandoyodiBengkulu,Rabu.Kemudianketikadipondokkecil,tersangkasempatmengasahduluparangyangdigunakannyauntukberkebundantidakberselanglamaSerkaHalilPutratibaditempatkejadianperkara(TKP).BacaJuga:PengacaraIstriFerdySamboNgototLaporkanBrigadirJAtasDugaanPencabulan,PengalihanIsu?Dalamrekonstruksitersebut,korbandantersangkasempatcekcokmulut,dankorbansempatmenantangtersangkauntukmelakukanpembacokan.Setelahkorbandibacok,tersangkakembalikepondokkebunnyauntukmengambilsepedamotordanpulangkerumah.BareskrimPolrimemastikanakanmemeriksaIrjenFerdySambopadahariini.Foto:DokInstagramKadivPropamPolri.jpnn.com,JAKARTA-KadivPropamnonaktifIrjenFerdySamboakandigarappenyidikBareskrimPolripadahariini,Kamis(4/8),sekitarpukul10.00WIB.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});(Pemeriksaan)dijadwalkanbesolink slot depo 10rbk(Kamis,red)padajam10,kataDirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenPol.AndiRianDjajadidiMabesPolri,Jakarta,Rabu(3/8)malam.DalamperkarayangdisebutpolisisebagaibakutembakantaraBharadaEdenganBrigadirJdirumahdinasIrjenFerdyitu,penyidiksudahmemeriksasebanyak42saksi.BacaJuga:TernyataBrigadirJ,Putri,danBharadaELakukanHalIniBersama,AdaPRTJugaPemeriksaantermasukdidalamnyaahli-ahli,sepertipakarbiologikimia,forensik,kedokteranforensik,danlaboratoriumforensik.Dari42saksiyangdiperiksaitu,Andimelanjutkansudahtermasuk11saksidaripihakkeluargaBrigadirJdantujuhajudanFerdySambo,satudiantaranyaBharadaEyangkinitelahditetapkansebagaitersangka.Namun,darisekianbanyaksaksiyangsudahdiperiksa,istriIrjenFerdySambobernamaPutriCandrawithibelumdigarappolisi.BacaJuga:SoalStatusIrjenFerdy,KompolnasSampaiMemintaKapolriMelakukanIniSampaisaatiniuntukIbuPutrimasihbelumbisadilakukanpemeriksaan,ujarAndi.PenyidiktelahmenetapkanBharadaEsebagaitersangkadalamkasusyangmenewaskanBrigadirJpadaJumat(8/7)laluitu.

link slot depo 10rb-🎖️game memancing yang menggerakkan hp|XOXE88.COM

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaEmenjaditersangkakasuspembunuhanBrigadirYosuaatauBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-BhayangkaraDuaRichardEliezeratauBharadaEyangkononmengakutelahmenembakiYosuaHutabarataliasBrigadirJ,ditetapkansebagaitersangkapadaRabu(3/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BerikutlimafaktabaruseputarBharadaEyangterungkapdalamkonferensipersdiMarkasBesarKepolisianNegaraRepublikIndonesiamalamtadi.1.BharadaEmenjaditersangkasetelah26harikematianBrigadirJ,yaknipadaJumat,8Juli2022.2.BharadaEmenjaditersangkadengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.Penyidiktelahmelakukangelarperkara.SudahkamianggapcukupuntukmenetapkanBharadaEsebagaitersangka,dengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP,kataDirekturTindakPidanaUmumBareskrimPolriBrigadirJenderalAndiRianDjajadidiMabesPolrimalamtadi.BacaJuga:BharadaEMenyampaikanSesuatuyangAkanMengancamnyaBunyiPasal338KitabUndang-UndangHukumPidana:Barangsiapadengansengajamerampasnyawaoranglain,diancamkarenapembunuhandenganpidanapenjarapalinglamalimabelastahun.JunctoPasal55:(1)Dipidanasebagaipelakutindakpidana:1.merekayangmelakukan,yangmenyuruhmelakukan,danyangturutsertamelakukanperbuatan;2.merekayangdenganmemberiataumenjanjikansesuatudenganmenyalahgunakankekuasaanataumartabat,dengankekerasan,ancamanataupenyesatan,ataudenganmemberikesempatan,saranaatauketerangan,sengajamenganjurkanoranglainsupayamelakukanperbuatan.(2)Terhadappenganjur,hanyaperbuatanyangsengajadianjurkansajalahyangdiperhitungkan,besertaakibat-akibatnya.JoPasal56Dipidanasebagaipembantukejahatan:1.merekayangsengajamemberibantuanpadawaktukejahatandilakukan;2.merekayangsengajamemberikesempatan,saranaatauke-teranganuntukmelakukankejahatan.BacaJuga:Konon,MahfudMDDapatBuktidariPihakBrigadirJ,LaluGeleng-gelengKepala3.BharadaEkiniberadaditanganBareskrimPolri.BharadaEsekarangadadiBareskrim.Setelahdiperiksasebagaitersangka,langsungditangkapdanditahan,kataBrigjenAndi.4.BharadaEbukanmembeladiri.BrigjenAndiRianmenyebutdarihasilpenyidikanhinggadilakukangelarperkaraBharadaEterbuktimelanggarPasal338.IrjenFerdySambosaattibadimarkasBareskrimPolri,Kamis(4/8)pagi.Foto:Ricardo/JPNNjpnn.com,JAKARTA-InspekturJenderalFerdySambomemohonmaafkepadaPolriatasinsidenkematianBrigadirYosuaHutabaratatauBrigadirJdirumahdinasnya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Jenderalbintangduatersebutmenyampaikanpermohonannyaitudidepanawakmedia,saattibadilobiBareskrimPolri,Kamis(4/8)sekitarpukul09.55WIB.IrjenFerdySambodatangkeBareskrimuntukdiperiksadalamkasuspembunuhanBrigadirJ.BacaJuga:LihatTampangIrjenFerdySamboSebelumDigarapBareskrimPolriKasusitusendiritelahmemunculkantersangka,yakniBhayangkaraDuaRichardEliezeratauBharadaE.Sayainginmenyampaikanpermohonanmaafkepadainstitusi(Polri)terkaitdenganperistiwayangterjadidirumahdinassayadiDurenTiga,kataPakSambo.KadivPropamnonaktifkelahiranKabupatenBarru,SulawesiSelatan,9Februari1973inijugamenyampaikanbelasungkawaatasmeninggalnyaBrigadirJ.BacaJuga:MengenalIrjenFerdySambo:AnakJenderal,PerwiraMetropolitanyangTakPernahkeLuarJawaSemogakeluargadiberikankekuatan.Namun,semuaituterlepasdariapayangtelahdilakukanYosuakepadaistridankeluargasaya,katanya.FerdySambomenyebutkankehadirandirinyamemenuhipanggilanpenyidikinibukanyangpertamakali.AnggaWijaya.Foto:Instagram/anggawijaya88jpnn.com,JAKARTA-AnggaWijayakembalimembeberkanpenyebabdirinyamantapberceraidenganDewiPerssik.SalahsatunyalantaranmendengarlangsungpernyataandariDewiPerssik.Saatditanyakalimlink slot depo 10rbatapayangdikatakanDewiPerssiktentangdirinya,AnggaWijayaengganmembeberkannya.BacaJuga:MerasaDapatTekananMenikahdenganDewiPerssik,AnggaWijaya:NengTidakBahagiaSamaSayaAkupernahmendengarstatementdaribeliaulangsung.Mungkinbeliauenggaktahuakudengar.Sampaiakhirnyaakuokebulat(gugatcerai),seruAnggaWijaya.Mantanpegawaibankinimeyakinijikamemaksakandiritetapmempertahankanrumahtanggayangtidakbaik-baiksaja,makaitusikapyangegois.Kalauenggakbegituakunyaegois.Akuresearchselamaduabulan,sampaibenarbulatakuambilkeputusan(bercerai),kataAnggaWijaya.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?JasaRaharjaSerahkanSantunanKepadaAhliWarisKorbanKecelakaanKendaraanDinasBakamlaDiapunmemintamaafkepadaDewiPerssik,jikaselamamenjadisuamitidakbisasepertiyangdiharapkan.Akubanyakkekurangannya,akusadar,ucapAnggaWijaya.(chi/jpnn)VideoTerpopulerHariini:KepalaDivisiProfesidanPengamanannonaktifIrjenFerdySambomenjalanipemeriksaansebagaisaksikasuspembunuhanBrigadirJ,digedungBareskrimPolri,Jakarta,Kamis(4/8).Foto:Ricardojpnn.com,JAKARTA-KepalanonaktifDivisiPropamPolriIrjenFerdySambomemenuhipanggilanpemeriksaanpenyidikBareskrimPolripadaKamis(4/8)hariini.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});FerdySambotampakmengenakanpakaiandinasharian(PDH)Polriketikatibapukul09.56WIB.DiamenggunakanmobilToyotaKijangInnovaberwarnahitamkemarkasyangdipimpinolehKomjenAgusAndriantoitu.BacaJuga:IrjenFerdySambo:SayaInginMenyampaikanPermohonanMaafDiaakandiperiksasebagaisaksikasuskematianyangmenewaskanBrigadirNofryansahYosuaHutabaratatauBrigadirJ.Daripantauan,eksKoorspripimKapolriitumengenakanPDHdengantandakorpskesatuanPropamPolridibahusisikanandansisikirinya.Taklupapula,suamiPutriCandrawathiitumengenakantandapangkatbintangduadikeduapundaknya.BacaJuga:IrjenFerdySamboBukaSuarakeMedia,SebutNamaBrigadirYosuaSayahadirmemenuhipanggilanpenyidikBareskrimPolri.Pemeriksaanhariiniadalahpemeriksaanyangkeempat.SayasudahmemberikanketerangankepadapenyidikPolresJaksel,PoldaMetroJaya,dansekarangyangkeempatdiBareskrimPolri,kataSambodiBareskrimPolri,Kamis.FerdyitumemintamaafkepadaKorpsBhayangkaraatasinsidenberdarahdirumahnya.KepalaDivisiProfesidanPengamanannonaktifIrjenFerdySambomenjalanipemeriksaansebagaisaksikasustewasnyaBrigadirJ,digedungBareskrimPolri,Jakarta,Kamis(4/8).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KadivPropamPorlinonaktifIrjenFerdySambomemintamaafkepadaKorpsBhayangkaraatasinsidenyangmenewaskanBrigadirNofryansahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidentersebutmelibatkanBhadaraEdanBrigadirJdirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).SayajugainginmenyampaikanpermohonanmaafkepadainstitusiterkaitperistiwayangterjadidirumahdinassayadiDurenTiga,kataFerdySambodiBareskrimPolri,Kamis(4/8).BacaJuga:BharadaEJadiTersangkaKasusKematianBrigadirJ,BeginiReaksiKamaruddinSimanjuntakJenderalbintangduaitukemudianmenyampaikanbelasungkawaterhadapkeluargaBrigadirJ.FerdySamboberharapkeluargaBrigadirJdiberikankekuatan.Namun,semuaituterlepasdariapayangtelahdilakukanSaudaraYosuakepadaistridankeluargasaya,ujarFerdySambo.BacaJuga:IrjenFerdySamboBukaSuarakeMedia,SebutNamaBrigadirYosuaSelainitu,FerdySambomemintamasyarakatagartidakberspekulasiliaratasinsidentewasnyaBrigadirJ.Sayaharapkankepadaseluruhpihak-pihakdanmasyarakatuntukbersabar,tidakmemberikanasumsi,persepsiperistiwadirumahdinassaya,tambahnya.

KabareskrimPolriKomjenAgusAndrianto.Foto:sourceforJPNN.comjpnn.com,JAKARTA-KabareskrimPolriKomjenAgusAndriantomengungkapalasanpihaknyatidakmenjeratBharadaRichardEliezeratauEdenganPasal340KUHPtentangPembunuhanBerencana.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEhanyadijeratPasal338KUHPtentangPembunuhanjunctoPasal55danPasal56KUHPdalamkasuskematianBrigadirNofriansyahYosuaHutabaratatauJ.MenurutAgus,kasusyangmenjeratBharadaEinimasihberprosesdiDirektoratTindakPidanaUmum(Dittipidum)Bareskrim,sehinggamasihadapotensipasallainyangditerapkan.BacaJuga:FerdySamboBerbelasungkawa,ResponsKeluargaBrigadirJMenohokKenapatidakditerapkanPasal340KUHP,karenainimasihrangkaianprosespendalamandaritemuan-temuanselamapemeriksaanolehtimsus,kataAguskepadawartawandiBareskrimPolri,Kamis(4/8).Timkhusussedangmemeriksa25personelkepolisiandalamkasuskematianBrigadirJ.PuluhanpersonelpolisitersebutdiperiksakarenadidugatidakprofesionaldalampenanganankasusdilokasikejadianpenembakanyangterjadidirumahdinasIrjenFerdySamboitu.BacaJuga:IrjenSyahardiantonoDitunjukSebagaiKadivPropamGantikanFerdySamboPerinciandaripuluhanpersonelitu,yaknitigapersonelberpangkatpati(perwiratinggi)bintangsatu,limapersonelberpangkatkombes,tigapersonelberpangkatAKBP,duapersonelberpangkatkompol,tujuhpersonelberpangkatperwirapertama(pama),danlimapersonelberpangkatbintaradantamtama.Ke-25orangituberasaldarikesatuanPropam,PolresMetroJakartaSelatan,PoldaMetroJaya,danBareskrimPolri.PengacaraHotmanParis.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismengakukerapdihubungiolehmantanasistenpribadinya(aspri)IqlimaKim.Diamenyebutperempuanitujugamengundanguntukdatangkeulangtahunnyabeberapawaktulalu.BacaJuga:DituduhMenciumIqlimaKimdiMobil,RazmanArifNasutionBeriTanggapanDiaterus-terusanmengundangsaya,tetapisayaenggakmau,ujarHotmanParisdikawasanKelapaGading,JakartaUtara,Kamis(4/8).BacaJuga:KuasaHukumSebutIstriIrjenFerdyHarusDianggapBenar,SampaiNamun,diaogahdatangkepestaulangtahunmantanasprinyaitu.SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.

KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.

link slot depo 10rb-🎖️game memancing yang menggerakkan hp|XOXE88.COM

AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.

Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatAjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KetuaIndonesiaPoliceWatch(IPW)SugengTeguhSantosomendukunglangkahKapolriJenderalListyoSigitPrabowoterkaitpenanganankasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KasusituinisemuanyaditanganiBareskrimPolri,mulaidarikasuskematian,dugaanpembunuhanberencanaterhadapBrigadirJ.KemudiandugaanpelecehandanancamanpembunuhanyangdialamiPutriCandrawathi,istriIrjenFerdySambo.MenurutSugeng,sudahsaatnyaPolrimenjeladlankepadapublikapayangsebenarnyaterjadidalaminsidenbakutembakdirumahIrjenFerdySamboitu.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanSugengmenyebuthalituperlukarenaBrigadirJdanBharadaEbukanyangsebatasajudanIrjenFerdySambo.KeduapolisiitumerupakananggotaSatuanTugasKhusus(Satgassus)PolribentukanKapolri.DaripenelusuranIPW,BrigadirJyangtewasditembakmerupakananggotasatgassus.LaluBharadaRichardEliezerjugaanggotasatgassus,kataSugeng.BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolKemudianinsidenberdarahiniterjadidirumahdinasIrjenFerdySamboyangjugasebagaiKetuaSatgassusPolritersebut.Olehsebabitu,KapolriharustegasmenanganikasusinisesuaiperintahPresidenJokowiuntukdiproseshukum,terbuka,danjanganditutup-tutupi,ujarSugeng.PenampakanpesawatelektrikEHang216yangberencanadioperasikansebagaitransportasiumumdiIndonesia.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengusahaRudiSalimberencanamembangunbisnistaksiterbangdiIndonesia.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});SahabatRaffiAhmaditubakalmenjadikanpesawatelektrikEhang216sebagaitaksiterbang.LantasberapasebenarnyahargaEhang216?BacaJuga:BamsoetDukungPengadaanEHang216sebagaiOfficialAircraftIMIRudiSalimengganblak-blakanmengenaihargaasliEhang216.Namun,diamembuatperumpamaanterkaithaltersebut.Kisaranlebihmurahdarisupercar,deh,pokoknya,kataRudiSalimsaatditemuidikawasanKemayoran,JakartaPusat,Minggu(31/7).RudiSalimmengatakanbiayaperawatanEhang216jugatergolonglebihmurahdaripadapesawatkonvensional.BacaJuga:RudiSalimBerencanaBangunBisnisTaksiTerbangdiIndonesiaSebab,Ehang216beroperasimenggunakandayalistrik.Tenagalistrikyangdiperlukanuntuksatupesawateletrikinijugadisebuttidakbesar.Jadi,sangataffordable,imbuhnya.

BhayangkaraDuaRichardEliezeratauBharadaEdikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardojpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatinsidenpolisitembakpolisidirumahKadivPropamnonaktifIrjenFerdySamboternyatatelahkembalikekesatuanasalnya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalitudiungkapkanKepalaDivisiHumasPolriIrjenDediPrasetyodiJakarta,Minggu(31/7/2022).DiamenyebutkanalasanBharadaEkembalikeBrimobkarenayangbersangkutanmasihberstatussebagaisaksidalamkasuspolisitembakpolisi.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriYa,karenastatusnyamasihsebagaisaksi,kataDedi.IaengganmenjelaskanlebihdetailterkaitdenganalasanpenarikanBharadaEkeMakoBrimob.Sementaraitu,BharadaRichardEliezeratauBharadaEdiketahuisebagaianggotaBrimobyangdiperbantukandiDivisiPropamPolridanmenjadiajudanIrjenPol.FerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhBharadaEdidugaterlibatbakutembakdenganBrigadirNofriansyahYosuaHutabaratatauBrigadieJdirumahKadivPropamPolriIrjemPol.FerdySambodiDurenTiga,JakartaSelatan,Jumat(8/7).Kepolisianmenanganitigalaporandalamperistiwatersebut,yakni:pertama,laporanberkenaandengandugaanpelecehanseksualataupencabulan;kedua,berkenaandengandugaanpengancamandankekerasansertapercobaanpembunuhan.KapoldaMetroJayaIrjenFadilImran.Foto:DokumenJPNN.com/Ricardojpnn.com,JAKARTA-KabidHumasPoldaMetroJayaKombesEndraZulpanmengatakanpihaknyatelahmenghentikanpenyidikankasuspenyuntinganprofilKapoldaIrjenFadilImrandilamanWikipediasehinggamenjadihoaks.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Penghentiankasustersebutsesuaidengankeputusankapoldayangtelahmemaafkanpelaku.Kasusnyadihentikan,kataEndraZulpandiJakarta,Minggu.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuDiamenambahkanpelakuyangdiketahuibernamaNyomansaatinitidakdilakukanpenahanandantelahdipulangkankerumahnya.Iya,sudahdipulangkan,ujarZulpan.PelakudiketahuisebelumnyatelahbertemudenganIrjenFadilImran.BacaJuga:IdentitasPelakuPembunuhanMayatTerlilitLakbanTerungkap,DiaTernyataPertemuankeduanyaitujugadiabadikandalamunggahanmelaluiakunKapoldaMetroJayadiInstagram.Dariawalsayajugatidakpernahmelaporkan,tidakmerasasakithatisamasekalidenganeditan-editanNyomanitu,tidakada,kataFadilImrandalamunggahanvideotersebut.

link slot depo 10rb-🎖️game memancing yang menggerakkan hp|XOXE88.COM

PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.IlustrasiFoto:Ricardojpnn.com,JAKARTA-PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});JabatanitulalutetapdipakaiolehKapolriselanjutnyasampaisaatini.PembentukansatgasinidibuatsejakKapolridijabatJenderalTitoKarnavianhinggaberlanjutkepadaIdhamAzisdankiniListyoSigit,kataEdidalamketerangannya,Minggu(31/7).BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDirekturEksekutifLemkapiitumenerangkankasatgassushanyabisadifungsikanolehKapolrisewaktu-waktudiperlukan.Diamencontohkansatgasinidiperlukansaatadagangguanperekonomiannasional.Meskidemikian,menurutEdi,jabatankasatgasadalahposisitambahanpejabatKadivPropamPolri.BacaJuga:AutopsiBrigadirJDilaksanakanHariIni,KapolriBicarasoalTanggungJawabSaatjabatanKadivPropamPolridicabut,makadengansendirinyaposisikasatgassusotomatisakanhilang.DanhalituberlakuterhadapIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirekturEksekutifLemkapiEdiHasibuanmeragukanpendapatsejumlahpihakbahwaIrjenFerdySambobisamengintervensipenyidikankasuspenembakanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutEdi,penanggungjawabtimkhususyangdibentukKapolriJenderalListyoSigitPrabowoituialahWakapolriKomjenGatotEddyPramono.TanpamengurangirasahormatsayadenganFerdySambo,diatidakbisamenekanapalagiintervensidalamkasusini.ApalagiketuatimkhususPolrisendiriadalahWakapolriKomjenGatotyangnotabeneadalahjenderalbintangtiga,katadia.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaSelainWakapolri,timkhususjugadiisiIrwasumKomjenAgungBudiMaryoto,KabareskrimKomjenAgusAndrianto,danKabaintelkamKomjenAhmadDofiri.Jadi,logikanya,bagaimanamungkinjenderalbintangduatanpajabatanbisaintervensiWakapolri,Katadoktorilmuhukumitu.Edijugamenyampaikanbahwajabatankepalasatgaskhusus(Kasatgassus)yangdisandangIrjenFerdySambosudahmenghilangsetelahkedudukanyangbersangkutansebagaiKepalaDivisiPropamPolridinonaktifkan.BacaJuga:LemkapiAnggapPutusanPDTHBrotosenoPenuhiRasaKeadilanSaatjabatanKadivPropamPolridicabut,makadengansendirinyajabatanKasatgasyangdisandangnyaotomatisakanhilang,kataEdi.Menurutnya,jabatankasatgasmerupakanposisitambahanKadivPropamPolri.

VerrellBramasta.Foto:Instagram/bramastavrljpnn.com,JAKARTA-AktorVerrellBramastadilarikankesalahsaturumahsakitbaru-baruini.Diaharusmenjalaniperawatanlantaranmengalamicederadibagianwajah.Akusekaranglagidirumahsakit,kemarinakujatuh,kataVerrelllBramastamelaluiakunmiliknyadiInstagram,Minggu(31/7).BacaJuga:CiumTangan,AldiTaherMintaMaafkepadaDinarCandyMantanpacarNatashaWilonaitumengakumengalamilukaaliasrobekdibagiandekatalis.VerrellBramastamenyebutlukatersebutakibatterbenturdenganfirehydrant.Akulukarobek,kenafirehydrant,jelaspemainsinetronPutriuntukPangeranitu.BacaJuga:SeringaiKembali,LaluSuarakanProtesuntukKominfoVerrellBramastaketakutanlantaranlukatersebutharusdijahitolehtenagamedis.Demimenghilangkanrasatakut,cowok25tahunitumemilihmelakukansiaranlangsungdiInstagram.Joshua,pembocordatarahasia.IlustrasiFoto:Antarajpnn.com,JAKARTA-KementerianKomunimasidanInformatika(Kemenkominfo)akhirnyabukasuaramengenaidatapenggunayangbisadilihatsetelahmendaftarkanpenyelenggarasistemelektronik(PSE).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});Diamenegaskantidalbisamelihatdatapenggunameskipunsudahmendaftarkan.Menurutdia,aksesdatapribadipenggunahanyabisadilakukanolehaparatpenegakhukumdaninstansiyangmemilikikewenangan.BacaJuga:KemenkominfoBlokirSejumlahPlatformLuarNegeri,SandiagaUno:TidakBisaSeenaknyaAktivitasitupunharusdalamkondisitertentu.Kamitidakbisamelihatdatapribadisepetipercakapan,kataDirekturJenderalAplikasiInformatika,Kominfo,SemuelAbrijaniPangerapan,dalamjumpapersvirtual,Minggu(31/7).MenurutSemuel,kondisiyangmembuatsebuahlembagabisamemintadatakepadaPSEantaralainadalahuntukmengungkapkejahatan.BacaJuga:KemenkominfoBlokirSteamHinggaOriginKarenaHalIni,Simak!DiamencontohkanPusatPelaporandanAnalisisTransaksiKeuangan(PPATK)bisamemintainformasikepadaPSEuntukmembuktikanpraktikpencucianuang.(Pihak)yangmemintadataharuspunyakewenangan.Kominfotidakuntukitu,kataSemuel.KuasahukumkeluargaIrjenFerdySambo,ArmanHanis,menyangkanperlakuanpublikterhadapkliennya.DokInstagramKadivPropamPolri.jpnn.com,JAKARTA-KuasaHukumIstriIrjenFerdySambo,ArmanHanismengingatkanpublikdanmediabahwakliennyaadalahkorbantindakpidanakekerasanseksual.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menurutdia,haltersebutkiniseolahtenggelamakibatberbagaiisuliaryangberkembangterkaitkematianBrigadirJ.Segalaisu-isuyangadamembuatdugaantindakpidanakekerasanseksualmalahmenjaditenggelam,padahalnegarayangkitacintaiinimenganutasaskemanusiaanyangadildanberadab,kataArmandalamketerangannyapadaMinggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataArmanmengatakansetiapperempuanrentanmenjadikorbanTPKS,bahkanseorangistrijenderalsekalipun.Diapunmengingatkansemuapihakbahwadalamkasuskekerasanseksual,perspektifkorbanharusdiutamakan.Bahwaapayangterjaditerhadapklienkamisaatiniharusdipercayaisampaiterbuktisebaliknya,jelasdia.BacaJuga:FerdySamboHanyaJenderalBintang2,TidakMungkinBisaMenekanKomjenGatotdkkOlehkarenanya,ArmanberharaptimkhususyangdibentukKapolriJenderalListyoSigitPrabowodapatmengungkapkasusinisecaratuntasdantransparan.HalitusebagaimanaperintahPresidenJokoWidodo(Jokowi),bahwakasusiniharusdiselesaikandanjanganadayangditutup-tutupi.AsnawiMangkualam(depan)saatmembelaAnsanGreeners.Foto:Facebook/AnsanGreenersFCjpnn.com,ANSAN-AsnawiMangkualamberhasilmelanjutkantrenpositifnyabersamaAnsanGreeners.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Terkini,diabarusajamencetakgolkeduanyabagitimberjulukTheGreenWolvestersebut.HalituterjadiketikaAnsanmenangtelak3-0atasJeonnamDragonsdiAnsanWaStadium,Minggu(31/7/2022),padalanjutanKLeague2ataukompetisikastakeduaLigaKorea.BacaJuga:TimBuluTangkisPersembahkanMedaliEmasPertamauntukIndonesiapadaAjangASEANParaGames2022AsnawimencetakgolpertamaAnsandilagaini,tepatnyamenit59,sedangkanduagolsisanyadibukukanolehbraceThiagoHenrique(68,72).Seusailaga,Asnawimengakupergantianpelatihturutmendongkrakpenampilannya.KepecayaandirinyameningkatsetelahAnsanGreenersdilatiholehLimJong-heon.BacaJuga:MenporaAmaliBicaraKesuksesanEkonomidiExpoUMKMASEANParaGames2022Pergantianpelatihturutberpengaruh(penampilannya,red).Sayamakinpercayadiridanmemangsayaakuikondisisayabelummaksimalpadaawalmusim,ucapAsnawiseusailaga.Sayakinimakinpercayadiriberkatkepercayaanyangdiberikanpelatih,imbuhnya.NikitaMirzanikembalisindirNindyAyunda.Ilustrasi.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-AktrisNikitaMirzanikembalimenyindirpenyanyiNindyAyundadimediasosial.SindiranituterkaitprotesyangdilayangkanNindypadasalahsatumedia.Banyakomonglu,NindyAyunda,tulisNikitaMirzanimelaluiakunInstagramputranya,Azka,Minggu(31/7).BacaJuga:NikitaMirzaniKembaliSerangNindyAyundaGegaraMasalahIniPesohorkelahiran17Maret1986inijugamenyinggungsikapNindyyangselalumenghindariawakmedia.Makanyakalauketemumediajangankaburlu.Gilirandiberitakanmedia,ngamuk,lanjutNikita.Sebelumnya,NindyAyundamengunggahsebuahtangkapanlayarpemberitaandirinyayangbakaldijemputpaksapolisi.BacaJuga:BaimWongDaftarkanCitayamFashionWeekkeHAKI,NikitaMirzaniBerkomentarBeginiNindymelaluiakunnyadiInstagram,takterimadiberitakansepertiitudanmemberiperingatankemediatersebut.MantanistriAskaraParasadyHarsonoitupunmemintamediatersebutuntukmenurunkanpemberitaantersebut.MenporaZainudinAmali.Foto:HumasKemenporajpnn.com,SOLO-MenporaZainudinAmalimengungkapkanbahwapenyelenggaraanASEANParaGamesSolo2022merupakanbentukperhatianPresidenJokoWidodo(Jokowi)terhadapatlet-atletdifabel.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Pasalnya,ajanginisudahempattahunatauduakalisecaraberturut-turuttidakdiselenggarakan.ASEANParaGames2022seharusnyatuanrumahadalahVietnam.Namun,merekatidakbersediamenyelenggarakanajangolahragaparalimpiktingkatAsiaTenggaraini.BacaJuga:ApaAlasanPenarikanBharadaEkeMakoBrimob?IrjenDediJawabBeginiAwalnyabukankitatuanrumahnyatapiVietnam.Karenanegara-negaralaintidakbersediamenyelenggarakan,makaatasarahanBapakPresidenJokoWidodountukmengajukandirimenjadituanrumah,kataMenporaAmali.MenporaAmalipunmenjelaskanalasanJokowimemberiarahankepadadirinyauntukmengambilkesempatanmenjadituanrumahASEANParaGameskarenainiakanmenjadiajangbagiparaatletdifabeluntukberkompetisidalammeraihprestasi.Sebab,paraatletparagameskesempatannyauntukbertandingsangatterbatas,terlebihsejumlahajangmultieventharusditiadakandanditundasepertiASEANParaGamesFilipina2019,AseanParaGamesVietnam2022,danAsianGamesGuangzhouyangditundaketahun2023.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDisisilain,ajangsingleeventjugasangatterbatas.OlehkarenaituPakPresidenJokoWidodomemberiarahankepadasayauntukmemberimerekaarenauntukbertanding.BelumtentukalaukitatidakjadituanrumahASEANParaGames2022initerlaksana,katanya.

KadivHumasPolriIrjenDediPrasetyoakuiBHaradaEditarikkekesatuanBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatbakutembakyangmenewaskanBrigadirYosuaHutabarat(BrigadirJ)dirumahKadivPropamnonaktifPolriIrjenFerdySambo,ditarikkekesatuannya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenbakutembakantaraBharadaEdenganBrigadirJkononterjadidirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).KepalaDivisiHumasPolriIrjenDediPrasetyopunmengakuipenarikanBharadaEkekesatuanbrigademobil(Brimob).BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolYa,karenastatusnyamasihsebagaisaksi,kataIrjenDedidiJakartapadaMinggu(31/7).Namun,jenderalbintangduaitutidakmemerincialasankesatuanmenarikBharadaE.BharadaEliezeratauBharadaEmerupakananggotaBrimobyangdiperbantukansebagaiaidedecamp(ADC)atauajudanIrjenFerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhAnggotaBrimobitubelakanganmenyitaperhatianpubliksetelahdisebutpolisiterlibatbakutembakdenganBrigadirJ.PolisimenyebutbakutembakitudipicudugaanpelecehanseksualdanpenodonganpistololehBrigadirJterhadapistriFerdySambo,PutriCandrawathi.KadivHumasPolriIrjenDediPrasetyodiMabesPolri,Jakarta,Rabu(20/7).Foto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeratauEditarikdarijabatanajudanIrjenFerdySambomenjadianggotaKorpsBrimobPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KabarpenarikanBharadaEkeKorpsBrimobinidibenarkanolehKadivHumasPolriIrjenDediPrasetyo.Ya(ditarikkeBrimob),karenastatusnyamasihsebagaisaksi,kataDedikepadawartawan,Minggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataSosokBharadaEdiketahuiikutterseretdalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.BharadEdisebutsebagaipenembakBrigadirJdirumahdinasIrjenFerdySambo.PenarikankeKorpsBrimobinidilakukanditengahprosespenanganankasuskematianBrigadirJmasihberjalan.BacaJuga:LawyerKeluargaSambo:IstriJenderalJugaBisaJadiKorbanPelecehanDedipuntidakmemerinciapaasalanutamaBharadaEditarikdariajudanIrjenFerdySambo.AdapunbakutembakantaraBharadaEdenganBrigadirJterjadidirumahdinasIrjenFerdySambodiDurenTiga,KecamatanPancoran,JakartaSelatan,Jumat(8/7).

KabareskrimPolriKomjenAgusAndriantosaatturundarimobildinasnyadidepanrumahIrjenFerdySambo,Senin(1/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-SejumlahpetinggiPolrimenyambangirumahdinasKadivPropamPolrinonaktifIrjenFerdySambo,diDurenTiga,JakartaSelatanpadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Rumahtersebutmerupakantempatkejadianperkara(TKP)bakutembakBrigadirNofryansahYosuaHutabaratatauBrigadirJdenganBharadaE.PantauanJPNN.comdilokasi,sekitarpukul10.46WIB,KabareskrimPolriKomjenAgusAndriantoyangnotabeneanggotatimsusyangdibentukKapolriJenderalListyoSigitPrabowotibadilokasi.BacaJuga:KabarTerbaruKasusBrigadirJ,JenderalBintang2IkutkeTKPBakuTembak,LihatItuJenderalpolisibintangtigaitutampakmengenakankemejaputih.KomjenAgusAndriantotakmemberikanpernyataanapapunsaatturundarimobildinasnyayangberwarnahitam.Sebelumnya,KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyohadirterlebihdahulu.BacaJuga:KabarTerbaruKasusIstriFerdySambo,PolrijugaPenginCepatKelarSaatini,keduajenderalitutelahmasukkerumahdinasIrjenFerdySambo.AdapunsebagianpetugaskepolisiantampakberadadiluargerbangrumahdinasIrjenFerdySamboitu.PTPanasonicGobelIndonesia(PGI)menggelarpromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.FotoPGIjpnn.com,JAKARTA-PTPanasonicGobelIndonesia(PGI)kembalimenggelarprogrampromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});PromoPanasonicBagi-bagiKebahagiaaninimerupakanwujudnyataPGIdalammemberikanprodukjugalayananterbaikbagipelangganuntukmendapatkankesempatancashbackhingga50%,padasetiappembelianproduk-produkPanasonicmelaluiWheelofHappiness(WoH).KeisukeNakagawa,PresidentDirectorPTPanasonicGobelIndonesiamengatakan,inisiatifpromodipertengahantahuninidiberikantanpamelihatadanyaharispesialataupuntanggalcantik,karenasalahsatuorientasibisnisPanasonicGOBELadalahmeningkatkankepuasanpelanggan.BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangPanasonicterusberupayamenciptakanLiveYourBestmelaluisetiapinovasilayanandenganmengadakanprogrampromoPanasonicBagi-bagiKebahagiaan,agardapatberkontribusidalammemberikankebahagiaandankesejahteraanbaikbagikonsumenmaupunmasyarakatdiseluruhIndonesia,ujarKeisukeNakagawa.Untukmendapatkanpromoinicaranyasangatmudah,konsumentinggalmembelisalahsatuproduk-produkfavoritPanasonic.Kemudiansetelahmelakukanpembayaran,setiappelangganberkesempatanmendapatkanpotonganhargadenganmelakukanSpinTheWheelsofHappinessdiwebsitebagibagikebahagiaan.com,ataudapatmengaksesdenganscanQRCodepadaBanneratauMateriPromosiyangadadisetiaptoko.BacaJuga:MenparekrafSandiagaBantuWargaKubuRayaTingkatkanPenghasilanLewatLidahBuayaTerpurukKarenaPandemi,2UMKMdiBaliIniBerhasilBangkitBerkatGoDigitalLangkahkedua,isibiodata,kategoriproduk,nomormodelproduk,nomorseri,tokopembelian,nomorkartugaransi,fotokartugaransisertafotoinvoice,danlangsungputarWheelsofHappinessuntukmendapatkancashbackdariRp25.000hinggaRp3.000.000,-dalambentukvouceryangakandikirimkankenomorteleponataue-mailyangsudahdidaftarkan.Kamiinginselalumemberikankejutandankebahagiaanbersamakonsumenmelaluiberbagaipromoyangkamibuat.MelaluiPanasonicBagi-bagiKebahagiaandiharapkandapatmemberikanmanfaatkepadasemuaorang,termasukpelanggansetiaPanasonic,seruMarketingDirectorPTPanasonicGobelIndonesiaYukiHonda.(chi/jpnn)

PutriZulkifliHasan,FutriZulyaSavitriresmiberceraidenganAhmadMumtazRais.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-PutrapolitikusAmienRais,AhmadMumtazRaisresmiberceraidenganFutriZulyaSavitri.Adapunpenyebabutamakeduanyaberceraiyaknilantaransudahtidakadalagikeharmonisandalamrumahtangga.HalinitercatatdalamsuratputusanceraiMumtazdanFutriyangdiunggahdiwebsiteMahkamahAgungRepublikIndonesia.BacaJuga:PutriZulkifliHasandanMumtazRaisResmiBercerai,BeginiIsiPutusannyaBerdasarkanketerangandalamsuratputusantersebut,keduabelahpihakdinyatakanseringribut.Awalnya2011,lantas2018,kemudian2020,selanjutnyabertengkarlagi2021,begitutertulisisiketerangandalamsuratputusanceraiMumtazdanFutri,dikutipSenin(1/8).Keduabelahpihakdisebutkantelahberupayauntukmenyelesaikanperselisihanyangterjadidalamrumahtangga.BacaJuga:5PernyataanMumtazRaisSoalRumahTangganyadenganPutriZulhas,Nomor2TegasBanget!Namun,padaakhir2021,hubungankeduanyajustrusemakinmemburuk.Haliniterbuktidaritidakadanyakomunikasiantaraduabelahpihak.Tidaksalingbertegursapaantarapenggugatdengantergugat,lanjutisiputusantersebut.DuapriayangdidugaajudanKadivPropamnonaktifIrjenFerdySambosaattibadikantorKomnasHAM,Menteng,JakartaPusat,Senin(1/8).Foto:RyanaAryaditaUmasugi/JPNN.comjpnn.com,JAKARTA-Sejumlahaidedecamp(ADC)aliasajudandanasistenrumahtangga(ART)KadivPropamPolrinonaktifIrjenFerdySambomendatangikantorKomisiNasionalHakAsasiManusia(KomnasHAM).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MerekadatangdanmemasukikantorKomnasHAMdiMenteng,JakartaPusat,sekitarpukul10.15WIB,padaSenin(1/8).KedatanganparaajudanFerdySamboitudalamrangkamemenuhipanggilanKomnasHAMyangmasihmemerlukanketeranganterkaitinsidenpolisitembakpolisiyangmenewaskanBrigadirJ.BacaJuga:KabarTerbaruKasusBrigadirJ,JenderalBintang2IkutkeTKPBakuTembak,LihatItuTerlihatsalahsatuajudanmengenakankauskerahabu-abuhitamlengkapdenganmaskerhitamdantopiberwarnasenada.Kemudianpriayangdidugaajudanlainnyamengenakankemejahitamdenganmaskerberwarnasama.Selainitu,priayangberjalanpalingterakhirmemakaikauskerahbirumuda,BacaJuga:KabarTerbaruKasusIstriFerdySambo,PolrijugaPenginCepatKelarAdajugaseorangperempuanyangmemakaiblusputihdenganhijabhitambermotif.MerekamasukdikawalolehtimpengamanandanstafdariKomnasHAM.

PutraAmienRais,AhmadMumtazRais.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-KelakuanPutraAmienRais,AhmadMumtazterbongkardalamrangkaiansidangceraidenganFutriZulyaSavitri,beberapawaktulalu.Dalamsidangcerai,FutrimembeberkansejumlahfaktamengenaisosokAhmadMumtazsaatmenjadisuaminya.DeretanfaktatersebuttercatatdalamsuratputusanceraiMumtazdanFutri,yangdiunggahdilamanMahkamahAgungRI.BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangDalamsuratputusancerainya,Mumtazdisebutmemilikikebiasaanmengonsumsiminumankeras.Kebiasaaniturupanyayangkerapmenjadisalahsatupemicupertengkarankeduanya.Prosesakhirnyaadalahterjadipertengkaranatauperselisihanantarapenggugatdantergugat,begitutertulisisisuratputusanceraiMumtazdanFutri,Senin(1/8).BacaJuga:PutraAmienRaisResmiBercerai,SebeginiNafkahyangHarusDiberikanKepadaMantanIstriImbasnya,Futriseringmendapatkankekerasandalamrumahtanggaakibatpertengkarantersebut.Taksangguplagimendapatsiksaanjasmanidanrohani,Futrimemutuskanmengajukangugatanceraikepengadilanagama.KuasahukumBharadaE,AndreasNahotSilitongamenyesalkanberbagaipernyataanterkaithasilautopsijenazahBrigadirJdikantorLPSK,Ciracas,JakartaTimur,Senin(1/8)Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-KuasahukumBharadaE,AndreasNahotSilitongamenyesalkanadanyabeberapakomentaryangdinilainyaliarsoalautopsiulangjenazahBrigadirNofryansahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DiamenyebutkanhasilautopsibelumdikeluarkanolehyangahlidibidangnyadalamhalinidokterforensikyangmelakukanautopsiterhadapBrigadirJ.Yangkamisayangkanpemberitaanyangberedar,yangmenurutkamipihaktidakbertanggungjawab.Bukanahlidibidangnyamenyampaikanpendapatyangseakan-akanbenar.Itusangatdisayangkan,kataAndreaskepadawartawandiKantorLPSK,Ciracas,JakartaTimur,Senin(1/8).BacaJuga:RabuNanti,KomnasHAMPeriksaUjiBalistikSenjatayangMenewaskanBrigadirJDiamenyebutkanseharusnyasemuapihakmengikutiproseshukummaupunpenyidikansecarakooperatif.Timforensikyangahliitubutuh4-8minggu.Namun,kitadengarpernyataandaripenasihathukumYosuaseakan-seakansudahbenarsemua,itukamisayangkan.Kamikooperatifdantidakadaditutupi,diamelanjutkan.AdapunpernyataanyangdimaksudialahsoaltemuanautopsiulangBrigadirJyangdisebutkanadalukatembakandarihidungmenembuskepala.BacaJuga:FaktaBaru,BekasdiLeherBrigadirJBukandariJeratanTali,TetapiIya(pernyataanitusalahsatunya).Ituseakan-akansudahkeluaratauhal-halyangdisampaikankepublik,dariforensiksajabutuh4-8minggu.Ituyangkamisayangkan,jelasdia.Andreasjugamemintakepadaseluruhpihakuntukmengikutiproseshukumdanpenyidikansecaradisiplindanmengedepankanrasasimpati.PedangdutDewiPerssikcarialamatAnggaWijaya.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PedangdutDewiPerssikmengakutidaktahualamattempattinggalmantansuaminya,AnggaWijayayangbaru.Diamengatakaninginmengembalikansemuabarang-barangmantansuaminyaituyangmasihtertinggaldikediamannya.Darikemarinkamisudahmemintaalamatdiauntukmengirimkanbarang-barang,ujarDewiPerssik,melaluisambunganvideocalldiPAJakartaSelatan,Senin(1/8).BacaJuga:Barang-barangAnggaWijayaMasihdiRumah,DewiPerssikMengakuBingungSoalIniMenurutDewiPerssik,sangmantantidakpernahmaumemberikanalamattempattinggalbarunyaitu.Darikemarin,kan,sudahmemilihbaju-bajusegalamacam,tetapidiasenggakpernahkasihalamat,ungkapnya.PelantunHikayatCintalantasmembeberkanbarang-barangAnggaWijayayangsudahdibungkusnyaitu.BacaJuga:DisinggungsoalTraumaMenikah,DewiPerssik:AkuSelaluMembangunRumahDukaBaju,sepatu,celanadalam,tuturmantanistriSaipulJamilitu.PengadilanAgamaJakartaSelatantelahmengabulkanpermohonanceraiAnggaWijayaterhadapDewiPerssik.Keduanyaresmiberceraipadahariini.SeksologDokterBoykeDianNugraha.Foto:Vidio/boykepediajpnn.com,JAKARTA-Seksologdr.BoykeDianNugrahaSpOGMARSmengatakanbahwaukuranorganintimpriaberbeda-beda.MenurutBoyke,ukuranalatvitalpriaIndonesiasamadenganSingapura,Jepang,danKorea.UkuranorganintimmerekadimasukkandalamrasAsia,katadokterBoyke,dikutipdarikanalCracyNikmirRealdiYouTube,Senin(1/8).BacaJuga:DokterBoykeIngatkanWanitaTidakSepertiInisaatBerhubungan,MoodPriaBakalDropDiamengatakanukurannormalalatvitalpriaAsiaitusekitar12sampai14cmpadasaatereksi.Menurutnya,ukurantersebutsudahbisamemuaskanwanitadiranjang.AlumnusFakultasKedokteranUniversitasIndonesiamengatakanbahwaukuranalatvitalpriarasTimurTengah,lebihbesardariAsia.BacaJuga:KataDokterBoyke,PosisidariBelakangMenyenangkanBagiWanitaSepertiIniUkurananupriaEropa,kataBoyke,tidakbedajauhdenganmilikTimurTengah.Nah,yangukurannyalebihbesarlagiiturasAfrika(rata-rata16,1017,9cm),ungkappemainfilmHoneymoonini.

PolisiberjagadirumahdinasIrjenFerdySambo,KompleksPolriDurenTigasaatprarekonstruksikasusbakutembakpolisiyangmenewaskanBrigadirJ,Jakarta,Sabtu(23/7/2022).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-AkademisidanIntelektualPublik,RockyGerungmenilai,langkahkepolisiandalammemproseskasusbakutembakajudandirumahdinasKepalaDivisiPropamNonaktif,IrjenFerdySambo,berjalanprofesionaldantransparan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sayakirakepolisianmasihdalamtahapprofesionalisme,yaknimengakuiadaduakorbandalamkasusini,ujarRocky,Senin(1/8).Diamenjelaskan,korbanpertamaByaknirigadirJaliasYosua.Diamenjadikorbandankarenaitutubuhnyapunyahakuntukmengucapkanjejakkriminalitasmelaluibahasayangdisebutsebagaiautopsi.BacaJuga:SalatTidakPakaiPeci,BagaimanaHukumnya?Jadiiniyangkitaharushormati,bahwahakkorbanmeskitelahmenjadijenazah,diabisatetapmengucapkanpengetahuandiatentangapayangterjadipadatubuhnyamelaluiilmuforensik,jelasRocky.KorbankeduayakniIstriIrjenFerdySambo.Menurutnya,perlindunganterhadapkorbankeduaharusdihargaisebagaihakprivasiyangmemerlukanproteksihukum,danituberlakudidalamprinsiphumanrights,terutamayangdisebuthakasasiperempuan.BacaJuga:ManjakanPelanggan,PanasonicBagi-bagiKebahagiaanIniyangmestikitahindari.jadisensasiterhadapfemmefatale,yaituketerlibatanperempuandanbiasanyaberkaitandenganisusensasiseksualitumestikitahilangkandulu,katanya.MenurutsalahsatuFounderSetaraInstituteini,scientificresearchakanmenjadicarayangdigunakanuntukmengungkapkanperistiwakematianBrigadirJ.KomisionerKomnasHAMMohammadChoirulAnam.Foto:Ricardojpnn.com,JAKARTA-KuasahukumkeluargaNopriansyahYoshuaHutabarataliasBrigadirJ,KamaruddinSimanjuntakmenyebutotakjenazahBrigadirJtidakberadapadatempatnyaatauberpindahkebagiandada.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menanggapiisuitu,KomisiNasionalHakAsasiManusia(KomnasHAM)engganmemberikanpernyataandanlebihmemilihmenungguhasilautopsi.BacaJuga:Kamaruddin:DokterKeluargaMenemukanOtakBrigadirJdiBagianDadaKamipercayapenjelasanketuatimyangmelakukanautopsidiJambidanmelibatkanberbagaiprofesordariberbagaiuniversitas.Kamitungguitusaja,kataKomisionerKomnasHAMRIMohammadChoirulAnamdiJakarta,Senin.Akantetapi,Anammenyarankanhal-halyangmenyangkutkedokteranforensiksebaiknyaditanyakanlangsungkepihakyangberwenangatauahlidibidangtersebut.Apalagi,katadia,terdapatbeberapadokterdariberbagaiuniversitasyangterlibatlangsungdariprosesautopsiulangjenazahBrigadirJ.BacaJuga:SoalKasusKematianBrigadirJ,AnamSorotiKerjaTimsusBentukanKapolri,JlebBangetTerkaitpemeriksaanAjudandanAsistenRumahTanggaKadivPropamPolrinonaktifIrjenPolisiFerdySambohariini(1/8),AnammengatakantimdariKomnasHAMmenggalisemuahalyangberkaitanlangsungdenganpihak-pihakdalamkonstruksiperistiwatersebut.IamengatakanterdapatfaktabaruyangdidapatkanKomnasHAM,khususnyayangterjadisaatrombonganIrjenPolisiFerdySambotermasukBrigadirJberadadiMagelang,JawaTengah.

PresidenJokowisaatmemberikansambutandalampembukaanacaraZikirdanDoaKebangsaan77TahunIndonesiaMerdekadihalamandepanIstanaMerdeka,Senin(1/8)malam.Foto:TangkapanlayarakunSetpresdiYouTubejpnn.com,JAKARTA-PresidenJokoWidodo(Jokowi)mengingatkankepadaseluruhrakyatIndonesiabahwaduniapadasaatinitidakberadadalamposisiyangbaik-baiksaja.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DuniayangbelumsepenuhnyapulihkarenapandemiCovid-19,dikejutkankembalidenganperangRusia-Ukrainayangmembawadampakberbagaiaspek.Munculkrisispangan,krisisenergijugasama,gassampaiharganyalimakalilipat,bensinnaikduakalilipat.Inilahkesulitan-inilahyangdialamihampirsemuanegara,kataJokowisaatmemberikansambutandalampembukaanacaraZikirdanDoaKebangsaan77TahunIndonesiaMerdekadihalamandepanIstanaMerdeka,Senin(1/8)malam.BacaJuga:IsiPertemuanJokowidenganPresidenZelenskydanVladimirPutinJokowimencontohkandampakterdekatdariperangUkrainadenganRusiayangmembawamasalahpangandiberbagaibenua.UkrainayangmerupakanpengimporgandumtidakbisamengeksporbarangpangannyaakibatperangdenganRusia.JokowipunmendapatkankabaritusaatmenemuiPresidenUkrainaVolodymyrZelenskyybeberapawaktulalu.BacaJuga:JokowiUngkapPembicaraanBarudenganPresidenRusiadanUkraina,SampaiDiulang-ulangAdastokdiUkrainadigudang22jutaton,stokprosespanen55juta.Artinya77jutagandumdiUkrainaenggakbisakeluarkarenaperang,katadia.DiRusia,lanjutJokowi,dirinyajugamenerimakabaryangsamadariPresidenVladimirPutin.FutriZulyaSavitri,istriAhmadMumtazRais.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-SopirpribadiFutriZulyaSavitrimembongkarkelakuanburukAhmadMumtazRaissaatmenjadisaksidalamsidangceraimajikannya,beberapawaktulalu.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesaksiansopirtersebuttercatatdalamsuratputusanceraiMumtazdanFutriyangdiunggahdilamanMahkamahAgungRI.Pada2021,saksi(sopirFutri,red)seringmelihatpenggugatdantergugatbertengkar,demikiantertulisisisuratputusanceraiMumtazdanFutri,dikutipSenin(1/8).BacaJuga:TerungkapFaktaBarudalamPerceraianPutriZulkifliHasandenganAhmadMumtazRaisDalamkesaksiannya,sangsopirmenyebutseringmelihatMumtazberlakukasarpadaFutrikarenamasalahsepele.Satuyangdiungkapkansangsopiryakniketikakeluargamajikannyatengahpergibersama.DiamenyebutMumtazmemarahiFutrikarenamengambilrutejalananyangmacet.BacaJuga:MbakNYMelaporkanBupatiBanyuasin,KepalaKUAAkhirnyaBukaSuara,TernyataTaksampaidisitu,MumtazjugadisebutmelemparFutridenganbotolairmineral.Tergugatmelemparpenggugatpakaibotolminumanmineralsampaikenaanak-anak,lanjutketerangandalamsurattersebut.

PengacarakekasihBrigadirJ,VeraSimanjuntak,RamoshutabaratdanFerdisaatmemberiketeranganseusaimendampingiklienyamenjalanipemeriksaandiMapoldaJambi,Minggu(24/7/2022).Foto:Deki/jambi-independent-jpnn.com,JAMBI-KuasaHukumVeraSimanjuntak,RamosHutabaratmemastikankliennyabatalmemintaperlindungankepadaLembagaPerlindunganSaksidanKorban(LPSK).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sebelumnya,kataRamos,kliennyasempatterbersituntukmendapatkanperlindungandariLPSK.Namun,niatitudiurungkankekasihmendiangNofriansyahYosuaHutabarataliasBrigadirJkarenaadapersyaratanyangmembuatkliennyatidaknyaman.RamosmengatakansyaratyangmenjadipertimbanganVeramembatalkanmintaperlindungankeLPSKadalahsoalkomunikasiyangakanterputusdengankeluargaketikadalamperlindunganLPSK.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriMenurutRamos,jikaseseorangyangdilindungiLPSKharusberadaditempatyangamandantidakdapatdihubungiolehpihakmanapun.KarenaketikadiamankanLPSK,semuapihaktermasukkeluargatidakbisamenghubungidahulu.Ituyangmenjadipertimbangannya,ujarnyadikutipdariJambiEkspres,Senin(1/8).SemenjakpemeriksaandiPoldaJambibeberapawaktulalu,santerinformasiyangmenyatakanVeraadalahsaksikunci,akibatnyaVeramerasaterancamdantidaknyaman.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaMisalnyakarenabertemudenganorangyangbelumdikenal,termasukawakmedia.Tidaknyamankarenabertemudenganorang-orangbaru,tuturRamos.IlustrasiPolri.Foto:dok.JPNN.comjpnn.com,JAKARTA-PendiriInstitutPerempuanValentinaSagalamenuntutPolrisegerabergerakmenindaklanjutilaporandugaankekerasanseksualterhadapPC,istriIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sepertidiketahui,PCdidugadilecehkanolehBrigadirJatauNofriansyahYosuaHutabaratyangtaklainadalahajudansuaminyasendiri.Terkaitdengandugaantindakpidanakekeraanseksualpelecehanseksualini,menurutsayapihakkepolisiantetapmelakukanpenyidikan,kataValentinaSagalasaatdihubungiwartawan,Senin(1/8).BacaJuga:PengacaraIstriFerdySamboHadirdiLPSK,Bawa3OrangPentingMenurutdiapenuntasankasusiniadalahamanatdariUUTPKSyangbarudisahkanbeberapabulanlalu.Makadariitu,katadia,penyidikkepolisianharusbergerakmengungkapkebenarandugaantersebut,sehinggaterwujudkeadilan.UUTPKSsudahmengaturpulasubstansihukumacara,kiranyabisadijalankanolehpenyidikagarkasusinimenemukankeadilanyangterangbenderang.KitatunggubagaimanahasilpenyidikandariKepolisian,jelasaktivisperempuanini.BacaJuga:KomjenAgusTibadiRumahFerdySambodenganMobilMewah,SpesifikasiMesinnyaNgeri!Sebelumnya,KuasaHukumIstriIrjenFerdySambo,ArmanHanismengingatkanpublikdanmediabahwakliennyaadalahkorbantindakpidanakekerasanseksual.Menurutdia,haltersebutkiniseolahtenggelamakibatberbagaiisuliaryangberkembangterkaitkematianBrigadirJ.

KomisionerKomnasHAMChoirulAnam.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KomnasHAMmenanggapipernyataankuasahukumkeluargaBrigadirJ,KamaruddinSimanjuntaksoalotakNofriansyahYosuaHutabaratyangadadibagiandada.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomisionerKomnasHAMMohammadChoirulAnammengatakanpihaknyabelumbisabicarabanyaksoalautopsiulangyangdilakukanpadaRabu(27/7)itu.Menurutdia,KomnasHAMmasihmenunggupenjelasanresmitimdokteryangterlibatdalamautopsiulang.BacaJuga:IstriFerdySamboKorbanTPKS,AktivisPerempuanDesakPolisiBergerakKamipercayapenjelasanketuatimyangmelakukanautopsidiJambidanmelibatkanberbagaiprofesordariberbagaiuniversitas.Kamitungguitusaja,kataAnamkepadawartawan,Senin(1/8).Diapunmenyarankanhal-halyangmenyangkutkedokteranforensiksebaiknyaditanyakanlangsungkepihakyangberwenangatauahlidibidangtersebut.AnamnmenyebutterdapatbeberapadokterdariberbagaiuniversitasyangterlibatlangsungdariprosesautopsiulangjenazahBrigadirJ.BacaJuga:FaktaBaru,PenembakanBrigadirJBerkaitandenganKejadiandiMagelang,ApaItu?KuasahukumkeluargaNofriansyahYosuaHutabarat,KamaruddinSimanjuntakmenyorotiautopsipertamayangdilakukanterhadapjasadmendiangsanakkliennya.MenurutKamaruddin,timdokteryangmengautopsiulangjenazahBrigadirJtidakmenemukanotakketikamembedahkepalaajudanIrjenFerdySamboitu.DewiPerssik.FotoInstagramjpnn.com,JAKARTA-PenyanyidangdutDewiPerssikmemberitanggapansetelahresmiberceraidariAnggaWijaya.Diamengakuhanyabisapasrahdanmenikmatiketikaharusberceraidanmenyandangstatusjandalagi.AkuenggakbisamengubahtakdirdariAllah.Jadi,akucumabisamenikmatidanmencobamenjadimanusiayanglebihbaik,kataDewiPerssikmelaluipanggilanvideodenganawakmedia,Senin(1/8).BacaJuga:3PernyataanDewiPerssikSetelahBerceraidariAnggaWijaya,TegasBangetPerempuanberusia36tahunitumenganggapsemuainiadalahjalandancobaandalamkehidupannya.DewiPerssikmemastikanbakalberusahamenjalansemuanyadenganikhlas.Namanyamanusiaya,akuharusmenerimaujianitudenganlapangdada,ucapDepe,sapaanDewiPerssik.BacaJuga:RubenOnsudanSarwendahBantuBiayaRenovasiMusaladiSukabumiMajelishakimPengadilanAgama(PA)JakartaSelatanresmimengabulkangugatanceraiAnggaWijayaterhadapDewiPerssik.AdapunDewiPerssikdanAnggaWijayakompaktidakhadirdalamsidangpembacaanputusanpadaSenin(8/1).FutriZulyaSavitriseusaisidangdiPengadilanAgamaJakartaSelatan.Diaresmiberceraidengansuaminya,AhmadMumtazRais.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-MajelishakimPengadilanAgamaJakartaSelatantelahmengabulkangugatceraiFutriZulyaSavitriterhadapAhmadMumtazRais.AdapunFutriZulyaSavitrimenggugatceraiputraAmienRaiskePengadilanAgamaJakartaSelatanpadaFebruari2022.Berikutfakta-faktaseputarputusanperceraianFutriZulyaSavitridanAhmadMumtazRais:BacaJuga:BorokPutraAmienRaisTerbongkarSetelahBerceraidariFutriZulyaSavitri,OhTernyata1.VonisCeraiBerdasarkanamarputusanyangdapatdiaksesdilamanMahkamahAgungbahwagugatanpenggugat,dalamhalini,FutriZulyaSavitri,dikabulkanmajelishakim.Selainitu,menjatuhkantalaksatuAhmadMumtazRaisterhadapFutriZulya.2.HakAsuhdanNafkahAnakDalamamarputusanitujugadisebutkanbahwaFutriZulyaSavitrimendapatkanhakasuhanak.BacaJuga:SopirPribadiFutriBongkarKelakuanBurukPutraAmienRais,PernahDikeplakAhmadMumtazRaisdiwajibkanmembayarnafkahanaksebesarRp30jutaperbulansampaikeduabuahhatinyadewasaataumandiri.Namun,nominalnafkahtersebutdiluarpendidikandankesehatan.KomisionerKomnasHAMChoirulAnamkembalimembeberkanhasilrekamanvideodirumahpribadiIrjenFerdySambo.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KomisionerKomisiNasionalHakAsasiManusia(KomnasHAM)ChoirulAnammengatakanterusmendapatkansejumlahdokumendandatabaru.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalitudisampaikanKomnasHAMseusaimelakukanpemeriksaandigitaldansiberdalamkasusbakutembakantaraBharadaEdenganBrigadirJdirumahKadivPropamnonaktifIrjenFerdySambo.Menurutdia,informasipertamadarirekamanvideoyangmerekadapatkanialahBrigadirJmasihhidupsaatrombonganIrjenFerdySambotibadiJakartadariMagelang.BacaJuga:FaktaBaru,BekasdiLeherBrigadirJBukandariJeratanTali,TetapiYangpalingpentingdarivideotersebut,diareaDurenTigamemperlihatkanadaIrjenSambo,rombongandariMagelang.IrjenFerdySambomasukduluan,setelahsekianwaktuadarombongan.DisituterlihatBuPutri,adaalmarhumBrigadirJ,ungkapAnam.Selainitu,diamelanjutkankasuspenembakanyangmenewaskanBrigadirJberkaitandengankejadiandiMagelang,JawaTengah.BacaJuga:TernyataBrigadirJ,Putri,danBharadaELakukanHalIniBersama,AdaPRTJugaSatulagiyangmembuat(informasi)inikaya,terkaitdenganapayangterjadidiMagelang,ungkapAnamsaatkonferensipersdikantorKomnasHAM,Seninkemarin.Namun,diajustrutakmengungkapkansecaraperincihaltersebut.

PutraAmienRais,AhmadMumtazRais.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PerceraianputraAmienRais,AhmadMumtazdenganFutriZulyaSavitrimenjadiberitaterhebohentertainmentJPNNsepanjangSenin(1/8).BorokAhmadMumtazpundibongkarsetelahresmiberceraidenganFutriZulyaSavitri.Selainitu,Mumtazharusmemberikannafkahkepadamantanistrinyaitu.BacaJuga:TerungkapFaktaBarudalamPerceraianPutriZulkifliHasandenganAhmadMumtazRaisKemudian,penyebabutamaperceraianMumtazdanFutriZulyapundiungkap.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BorokAhmadMumtazDibongkarKelakuanPutraAmienRais,AhmadMumtazterbongkardalamrangkaiansidangceraidenganFutriZulyaSavitri,beberapawaktulalu.BacaJuga:PutriZulkifliHasandanMumtazRaisResmiBercerai,BeginiIsiPutusannyaDalamsidangcerai,FutrimembeberkansejumlahfaktamengenaisosokAhmadMumtazsaatmenjadisuaminya.Bacaselengkapnya:BorokPutraAmienRaisTerbongkarSetelahBerceraidariFutriZulyaSavitri,OhTernyataPutriDelinaAndrianySutisnadanayahnya,Sule.FototangkapanYouTubejpnn.com,JAKARTA-KomedianSulemengabarkankondisidirinyayangsedangdropkarenakelelahan.Bapaklimaanakituharusdiinfussupayabadannyasegerabugarkembali.Dalamkesempatan,SulejugamemintaagarnetizentidaklagimenghujatPutriDelina,yangdianggapsebagaipenyebabNathalieHolscermelayangkangugatancerai.BacaJuga:SalatTidakPakaiPeci,BagaimanaHukumnya?Buatteman-temanyangmasihmenghujatPutri,please,berhenti,kasihanPutri.KarenasemuapermasalahaninibukankarenaPutri,ituyangharuskaliantahu,kasihan,pintaSuleyangsedangterbaringdikursi.Anak-anakenggaktahuapa-apa,yangjelaskamibaik-baiksaja,tanpamenjatuhkansiapapun,sambungnya.Meskibegitu,PriakelahiranCimahiiniengganmembahasjikaadanetizenyangbertanyamengenaipenyebabperceraiannya,jikabukankarenaPutriDelina.BacaJuga:DihujatGegaraPodcastdenganPutriDelina,MaiaEstiantyPastikantakAkanHapusVideonyaKalauadayangbertanyaapadongmasalahnya,cukupaku,diadanTuhanyangtahu,enggakperlukamikasihtahu,lanjutnya.DaripadaPutriDelinayangdi-bully,pria45tahuninimempersilahkandirinyadihujat.

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEseusaimenjalanipemeriksaandikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)memeriksasatuorangajudanatauaidedecamp(ADC)danasistenrumahtanggaIrjenFerdySambopadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Keduanyamenjalanipemeriksaanmulaisekitarpukul10.00WIBdanbaruselesaisekitarpukul17.15WIB.AjudanFerdySamboyangdiperiksaolehKomnasHAMpadaSeninkemarinsebelumnyaberhalanganhadir.BacaJuga:ArmanHarisUngkapKondisiTerkiniIstriFerdySamboPadaSelasa26Juli2022,KomnasHAMmengagendakanpemeriksaanterhadaptujuhorangajudanFerdySambo.Namun,hanyaenamyangdatangsalahsatunyaBharadaE.AgendaawalSenin(1/8),KomnasHAMjugaakanmemeriksaataumenggaliinformasidaripetugaskesehatanyangmelakukantesusapPCRdikediamanpribadiIrjenFerdySambodiJalanSaguling,DurenTigaJakartaSelatan.BacaJuga:IniHargaMobilMewahKomjenAgusyangMendatangiRumahFerdySambo,YaAmpun!Namun,kataKomisionerKomnasHAMRIBekaUlungHapsara,tenagakesehatanyangmelakukantesusapPCRtersebuttidakmemenuhiundanganpemeriksaan.Berikut5kabarterbaruperkembanganpengusutankasuskematianBrigadirNofriansyahYoshuaHutabarataliasBrigadirJyangdilakukanKomnasHAMhinggaSenin:Salat(Ilustrasi).Foto:Ricardo/jpnn.comjpnn.com-Salatmerupakankewajibanbagisetiaporangmuslimbalighdanberakal,kapanpundandimanapun.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Kewajibansalattidaktergoyahkanolehruang,waktudankeadaan.Namun,dalamrealitakehidupanmanusia,seringkalikesibukan-kesibukanmenjadikankitaterlena.BacaJuga:SalatTidakPakaiPeci,BagaimanaHukumnya?Sebenarnyaadabanyakhalyangmenjadikanseseorangbisamemperolehkeringanandiatas,misalnyamusafir(orangyangberpergiandengantidakadatujuanmaksiat).Olehkarenaitulahdalamfikihmengajarkansalatjamakdanqashar.Salatjamakadalahmengumpulkanduashalatdalamsatuwaktu,baikdilakukanpadawaktusalatpertama(jamaktaqdim)maupundilakukanpadawaktusalatyangkedua(jamaktakhir).BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangSedangkanqasharadalahmeringkassalatempatrakaatmenjadiduarakaatdengansyarat-syarattertentu,sepertisalatdhuhur,ashar,danisyak.Lalu,bagaimanasalatbagiorangyangsibukbekerja?

KononbakaladapetisipenjarakanNikitaMirzani.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-AdvokatIndraTarigansempatmengatakanbakalmembuatpetisipenjarakanNikitaMirzani.Dia,bahkanberencanamenggandeng200pengacaramembuatpetisitersebut.RekanIndraTarigan,AndyAmiruddinmengungkapkanakanmenembuskanpetisiitukeKapolri,KomisiIIIDPRRIhinggakePresidenJokoWidoao(Jokowi).BacaJuga:NikitaMirzaniHadiriWajibLapor,PolisiBilangBeginiKamitidakmain-maindalamhalini,ungkapAndyAmiruddin,diPolresJakartaSelatanbeberapawaktulalu.Namun,hinggakinikabarkelanjutanmengenaipetisiitutidakterdengarkembali.PetisitersebutdibuatterkaitbatalnyapenahananNikitaMirzanidiPolrestaSerangKota.BacaJuga:PenampilanNikitaMirzaniSaatMenjalaniWajibLapordiKantorPolisi,JanganBerkedipPemainfilmNenekGayungitusempatdijemputpaksapetugassetelahmenjaditersangkaataslaporanDitoMahendra.Setelahsempatmenginapsatumalam,NikitaMirzaniakhirnyadibebaskandengansyaratwajiblaporkePolrestaSerangKota.KomisionerKompolnasPoengkyIndarti.Ilustrasi.Foto:ANTARA/Evarukdijatijpnn.com,JAKARTA-KomisiKepolisianNasional(Kompolnas)angkatbicarasoalaspirasimasyarakatyangmemintaIrjenFerdySambodinonaktifkandarijabatanKepalaSatgasKhusus(Kasatgassus)Polri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KompolnasmengatakanuntukmemastikanmengenaistatusjabatanlainKadivPropamnonaktiftersebutpihaknyaakanmemintaklarifikasikepalaPolri.KamiakankroscekdulukePolriapakahPakFerdySambomasihmenjabatKasatgassusatautidak,kataanggotaKompolnasPoengkyIndartisaatdihubungiANTARAdiJakarta,Selasa.Kompolnasmasukdalamjajarantimkhusus(Timsus)yangdibentukolehKapolriJenderalPol.ListyoSigitPrabowodalammengungkapperistiwapolisitembakpolisidirumahIrjenPol.FerdySamboyangmenewaskanBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaMenurutPoengky,meskiberadadidalamtimsus,posisiKompolnastetapberadadiluarsebagaipengawaseksternalyangmengawasipenanganankasustersebut.SebagaipengawaseksternalPolri,KompolnasmengetahuidanmemahamidesakanpublikterkaitobjektivitasPolridalammengungkapkasustersebut.TermasukdesakanmemintaIrjenPol.FerdySambountukdinonaktifkandarijabatansebagaiKepalaSatgassusPolri.Kamitahudesakanpublik,tetapikamijugaperluklarifikasikePolriterkaitmasihmenjabatatausudahtidaklagimenjabatnyaPakFerdysebagaiKasatgassus.Sehinggaharusdipastikanmelaluiklarifikasi,ujarnya.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriNamunKompolnassependapatdenganmasyarakatagarFerdySambodinonaktifkandarijabatansebagaiKepalaSatgassusPolriuntukmemperlancarprosespenyidikan.Seyogyanyauntukmemperlancarprosespenyidikanmemangperlunonaktifuntuksemuajabatan,untukmencegahkemungkinankonflikkepentingan,kataPoengky.

Iklan Bawah Artikel